PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010915832.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family MYB
Protein Properties Length: 1097aa    MW: 120520 Da    PI: 5.1861
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010915832.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.71.3e-184995148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g WT+eEd +l +av+++ g++Wk+Ia++++  Rt+ qc +rwqk+l
   XP_010915832.1 49 KGQWTPEEDAILCRAVQKFRGKNWKKIAECFP-DRTDVQCLHRWQKVL 95
                     799*****************************.************986 PP

2Myb_DNA-binding61.81.4e-19101147148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g+W++eEde++++ v+++G++ W+tIa+ ++ gR +kqc++rw+++l
   XP_010915832.1 101 KGPWSKEEDEKIIQMVNKYGPKKWSTIAQALP-GRIGKQCRERWHNHL 147
                      79******************************.*************97 PP

3Myb_DNA-binding48.12.7e-15153195145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      +++WT+eE+  l++a++ +G++ W+   + ++ gRt++ +k++w+
   XP_010915832.1 153 KQAWTQEEEITLIHAHQIYGNK-WAELTKFLP-GRTDNAIKNHWN 195
                      799*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.8964495IPR017930Myb domain
SuperFamilySSF466894.05E-1645101IPR009057Homeodomain-like
SMARTSM007174.1E-164897IPR001005SANT/Myb domain
PfamPF002491.5E-164995IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.0E-2050103IPR009057Homeodomain-like
CDDcd001672.68E-145295No hitNo description
PROSITE profilePS5129432.1196151IPR017930Myb domain
SuperFamilySSF466891.4E-3198194IPR009057Homeodomain-like
SMARTSM007177.1E-19100149IPR001005SANT/Myb domain
CDDcd001671.40E-16103147No hitNo description
Gene3DG3DSA:1.10.10.607.8E-27104155IPR009057Homeodomain-like
PfamPF139213.0E-18104164No hitNo description
SMARTSM007174.6E-14152200IPR001005SANT/Myb domain
PROSITE profilePS5129419.329152202IPR017930Myb domain
CDDcd001678.07E-11155195No hitNo description
Gene3DG3DSA:1.10.10.603.6E-21156202IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1097 aa     Download sequence    Send to blast
MASDKEKGAK KGETSASPST AVQDGSSDEL QRQRLLHGRT TGPTRRSTKG QWTPEEDAIL  60
CRAVQKFRGK NWKKIAECFP DRTDVQCLHR WQKVLNPELV KGPWSKEEDE KIIQMVNKYG  120
PKKWSTIAQA LPGRIGKQCR ERWHNHLNPA INKQAWTQEE EITLIHAHQI YGNKWAELTK  180
FLPGRTDNAI KNHWNSSVKK KLDSYMASGL LAQFQGLPHV ENPAQCISSS VVNQQNSDNS  240
GFKDRQEVEY SSECSQGSSS ALVGCSQSDY ELANTVPLHD DIKLGEDAKK EDIQNSQLPM  300
CSEEYYTSME EIARVLPEIQ CGDDVAVTAP CHRVHEVEVS KSLANQMISE ELTNSLLEST  360
QKSPELKRTT EHRAHCVENY ESKSGSLPDP VGMEMPTSVT NSGLGSDNQG QLLIAEADCC  420
SDNLFGAAMH QDITLGDPFT APSITNIGYN SGSVNSQPDF CSSLDYRDLI SCSQPLYLIN  480
SSDMLGNSYC QGLMTVVPPS YVCPGDGKPT YGSDDVDMRE ISVGTQDSEL ITCTYGGFAY  540
SSCSSLLSPS GGARSKICAP ADRGKETESP KQTYMEMMGS ETPNATGKIT SQDENPAIQA  600
EEHQDSGALF YEPPRFPSLE IPFVSCDLIS SGDLQQAYSP LGIRQLMMSS TPYSLWDSPS  660
HDESPDALLR SAAKSFICTP SIMKKRQREL LSPLQERRID KKSGTDMDRV LFLTPISRTD  720
NSSLNTMNDE GGAYRNSSCS IDADAFSPSN HQKKKHEYCL EDKENLDHAP SCQKDESASM  780
EARISSKASS TSNFQAKMKQ CASTISVPTK LEVNVRETEQ PAGVLVEHNN NDMLLFATDR  840
DGHPINGHTS TAARSLKDQT FRSNEATPNK DNSAVPSKSL SDFSAFLSPG VGESEQVQHQ  900
VRVTSAQCAP RVHPSEVSIE KHGSSIDMDL ENLNIFADTP GIKRGIESPS AWKSPWFMNS  960
LLPGHTINTD ITFEDIGYFM SPVDRTYDAI GLMKQLSEHS ASVVAEAQEV LASGSPGGVS  1020
DKRHSGKENF QKENIQSDKE LEDHPNPMIS KVMTEARVLD FSACGTPVGK TGNKNVGNME  1080
TSVNLTSPSS YLIKGCR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C3e-68492026159MYB PROTO-ONCOGENE PROTEIN
1h89_C3e-68492026159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010915832.10.0PREDICTED: myb-related protein 3R-1 isoform X1
TrEMBLM0S9I00.0M0S9I0_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr2P19890_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP24953879
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G32730.11e-109Homeodomain-like protein